Résultats 1 à 9

Dates de soutenance :

Etablissements :

Valider et fermer
  • Paris Saclay (2)
  • Aix-Marseille (1)
  • Aix-Marseille 2 (1)
  • Albert-Ludwigs-Universität (Fribourg-en-Brisgau, Allemagne) (1)
  • Amiens (1)
  • Grenoble (1)
  • Perpignan (1)
  • Toulouse, INSA (1)
  • Université de Lorraine (1)

Etablissements :


Disciplines :

Valider et fermer
  • Biologie (3)
  • Biologie cellulaire et microbiologie (1)
  • Biologie végérale et forestière (1)
  • Biologie. Physiologie cellulaire et moléculaire des plantes (1)
  • Ingenieries microbienne et enzymatique (1)
  • Sciences de la vie (1)
  • Sciences de la vie et de la santé (1)

Disciplines :


Ecoles Doctorales :

Valider et fermer
  • Ecole Doctorale Sciences de la Vie et de la Santé (Marseille) (1)
  • RP2E - Ecole Doctorale Sciences et Ingénierie des Ressources, Procédés, Produits, Environnement (1)
  • École Doctorale Sciences Écologiques, Vétérinaires, Agronomiques et Bioingénieries (Toulouse) (1)
  • École doctorale Sciences du Végétal : du gène à l'écosystème (Orsay, Essonne ; 2015-....) (1)
  • École doctorale Sciences, technologie et santé (Amiens) (1)
  • École doctorale Structure et Dynamique des Systèmes Vivants (Gif-sur-Yvette, Essonne ; 2015-....) (1)
  • École doctorale chimie et science du vivant (Grenoble) (1)
  • École doctorale Énergie environnement (Perpignan) (1)

Ecoles Doctorales :


Langues :

Valider et fermer
  • anglais (8)
  • français (3)

Langues :


Directeurs de thèse :

Valider et fermer
  • Belin Christophe (1)
  • Cassier-Chauvat Corinne (1)
  • Choquet Yves (1)
  • Domon Jean-Marc (1)
  • Finazzi Giovanni (1)
  • Giauffret Catherine (1)
  • Gontero-Meunier Brigitte (1)
  • Jacquot Jean-Pierre (1)
  • Lemaire Stéphane (1)
  • Meunier Jean-Claude (1)
  • Portais Jean-Charles (1)
  • Rayon Catherine (1)
  • Reichheld Jean-Philippe (1)
  • Reski Ralf (1)

Directeurs de thèse :


Domaines :

Valider et fermer
  • Sciences de la vie, biologie, biochimie (8)
  • Plantes. Botanique (1)
  • Agronomie, agriculture et médecine vétérinaire (1)

Domaines :


9 thèses pour SBPase

...SKSKNGKLRLLYECAPMSYLAEQAGGKGSDGHQRILDIQPEQVHQRVPLYVGSTEEVEKL EKFLA Underlined – transit peptide sequence SBPase >Pp1s41_162V6.1_SBPase_transcript sequence...

Accéder en ligne

...-dependent regulation The 4 light-regulated enzymes GAPDH, PRK, FBPase and SBPase, are the classical examples of TRX...

Accéder en ligne

..., fructose-1,6-bisphosphate aldolase; FBPase, fructose-1,6-bisphosphatase; SBPase, sedoheptulose-1...

Accéder en ligne

...+NADPHMalateOAANADP+NADP+-MDHCalvin-Benson cycleTRXyTRXmTRXzTRXfLumenStromaGlucose 1-PCO2ADP-glucoseAGPaseAMP + PPiStarchPRK SBPase...

Accéder en ligne
Ingenieries microbienne et enzymatique

Soutenue le 23-05-2017
thèse soutenue

...-1,7-bisphosphate aldolase sbpase sedoheptulose-1,7-bisphosphatase SCP2 thiolase isoform 2 SCS (Sco...

Accéder en ligne
Biologie. Physiologie cellulaire et moléculaire des plantes

Soutenue le 14-12-2018
thèse soutenue

...BP: ribulose 1,5-bisphosphate; SBPase: sédoheptulose 1,7-bisphosphatase; V: violaxanthine; Z: zéaxanthine; A...

Accéder en ligne

...55800.1 S17P  (SBPase)   metabolism  carbon  Calvin  cycle 1.843695330588942.2859915874051e-­‐05AT5G...

Accéder en ligne

...FBP/SBPase pour produire du S7P (voir Figure 19). 2. Régulation générale du cycle de Calvin Le...

Accéder en ligne

Résultats 1 à 9